PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009495-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family Whirly
Protein Properties Length: 235aa    MW: 26377.1 Da    PI: 10.482
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009495-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly182.86.3e-57591951138
           Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 
                      svyk+k+a++ ++v p+f ++dsg +++kr+G+++l + ++++erkydW+kkq+falsatev++l+ l++ +sceffhdpa+k+ n+G+vrk+l
  AHYPO_009495-RA  59 SVYKGKTAFSAEPVPPEFIKVDSG-IRIKRQGFIMLSFSPSVGERKYDWQKKQRFALSATEVGSLIALGPTGSCEFFHDPAMKTNNAGQVRKSL 151
                      79********************99.689****************************************************************** PP

           Whirly  95 kvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsll 138
                      +++  pdG+G+f++l+v n+ +k+ne++++Pvs aefav+r+ +
  AHYPO_009495-RA 152 SIKANPDGTGYFFSLNVVNNTLKTNERLTLPVSSAEFAVMRTSF 195
                      *****************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.8E-6850213IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.33E-5951212IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.3E-5560193IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MMKLANLFKS RSIISRKLNH YNSTQEVSRS HSHALMSRAD ISTVGQKAFT NERIYAGYSV  60
YKGKTAFSAE PVPPEFIKVD SGIRIKRQGF IMLSFSPSVG ERKYDWQKKQ RFALSATEVG  120
SLIALGPTGS CEFFHDPAMK TNNAGQVRKS LSIKANPDGT GYFFSLNVVN NTLKTNERLT  180
LPVSSAEFAV MRTSFSYALP HIMGWDRYSS QHPRYEEGII MKGGQKTMHS EWNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3n1h_A1e-785321110169StWhy2
3n1i_A1e-785321110169protein StWhy2
3n1j_A1e-785321110169Protein StWhy2
3n1k_A1e-785321110169protein StWhy2
3n1l_A1e-785321110169protein StWhy2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677192.11e-111PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0344e-82WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLA0A0J8D1A61e-111A0A0J8D1A6_BETVU; Uncharacterized protein
STRINGVIT_18s0089g00900.t013e-80(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.11e-74WHIRLY 2